A6683
Pannexin 1 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A6683
- Zusätzliche Namen:
- MRS1|OOMD7|OZEMA7|Pannexin 1|PX1|UNQ2529
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 54kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- ISLAFAQEISIGTQISCFSPSSFSWRQAAFVDSYCWAAVQQKNSLQSESGNLPLWLHKFFPYILLLFAILLYLPPLFWRFAAAPHICSDLKFIMEELDKVY
- Uniprot:
- Q96RD7
- Synonyme:
- innexin;MRS1;OOMD7;pannexin-1;PX1;UNQ2529
- Weitere Details:
- The protein encoded by this gene belongs to the innexin family. Innexin family members are the structural components of gap junctions. This protein and pannexin 2 are abundantly expressed in central nerve system (CNS) and are coexpressed in various neuronal populations. Studies in Xenopus oocytes suggest that this protein alone and in combination with pannexin 2 may form cell type-specific gap junctions with distinct properties.
- Versandbedingungen:
- Blue Ice