NHLRC1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A6669
Zusätzliche Namen:: bA204B7.2|EPM2A|EPM2B|MALIN|NHLRC1
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 42kDa/45kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MAAEASESGPALHELMREAEISLLECKVCFEKFGHRQQRRPRNLSCGHVVCLACVAALAHPRTLALECPFCRRACRGCDTSDCLPVLHLIELLGSALRQSPAAHRAAPSAPGALTCHHTFGGWGTLVNPTGLALCPKTGRVVVVHDGRRRVKIFDSGGGCAHQFGEKGDAAQDIRYPVDVTITNDCHVVVTDAGDRSIKVFDFFGQIKLVIGGQFSLPWGVETTPQNGIVVTDAEAGSLHLLDVDFAEGVLRRTERLQAHLCNPRGVAVSWLTGAIAVLE
Uniprot:: Q6VVB1
Synonyme:: bA204B7.2;E3 ubiquitin-protein ligase NHLRC1;EPM2A;EPM2B;MALIN;NHL repeat containing 1;NHL repeat-containing protein 1;RING-type E3 ubiquitin transferase NHLRC1
Weitere Details:: The protein encoded by this gene is a single subunit E3 ubiquitin ligase. Laforin is polyubiquitinated by the encoded protein. Defects in this intronless gene lead to an accumulation of laforin and onset of Lafora disease, also known as progressive myoclonic epilepsy type 2 (EPM2).