A6667
NFKB1 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A6667
- Zusätzliche Namen:
- CVID12|EBP-1|KBF1|NF-kappa-B1|NF-kappaB|NF-kappabeta|NF-kB|NF-kB1|NFkappaB|NFKB-p105|NFKB-p50|NFKB1
- Anwendung:
- ELISA, WB, IHC-P, IF, ICC
- Molekulargewicht:
- 50 kDa/120 kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- GPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQAEGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQRKRQK
- Uniprot:
- P19838
- Synonyme:
- CVID12;DNA-binding factor KBF1;EBP-1;KBF1;NF-kappa-B1;NF-kappaB;NF-kappabeta;NF-kB;NF-kB1;NFkappaB;NFKB-p105;NFKB-p50;nuclear factor kappa-B DNA binding subunit;nuclear factor NF-kappa-B p105 subunit;nuclear factor NF-kappa-B p50 subunit;nuclear factor of kappa light polypeptide gene enhancer in B-cells 1
- Weitere Details:
- This gene encodes a 105 kD protein which can undergo cotranslational processing by the 26S proteasome to produce a 50 kD protein. The 105 kD protein is a Rel protein-specific transcription inhibitor and the 50 kD protein is a DNA binding subunit of the NF-kappa-B (NFKB) protein complex. NFKB is a transcription regulator that is activated by various intra- and extra-cellular stimuli such as cytokines, oxidant-free radicals, ultraviolet irradiation, and bacterial or viral products. Activated NFKB translocates into the nucleus and stimulates the expression of genes involved in a wide variety of biological functions. Inappropriate activation of NFKB has been associated with a number of inflammatory diseases while persistent inhibition of NFKB leads to inappropriate immune cell development or delayed cell growth. NFKB is a critical regulator of the immediate-early response to viral infection. Alternative splicing results in multiple transcript variants encoding different isoforms, at least one of which is proteolytically processed.
- Versandbedingungen:
- Blue Ice






_IHC_01.jpg)
_IHC_02.jpg)
_IHC_03.jpg)