A6651
MATK Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A6651
- Zusätzliche Namen:
- CHK|CTK|HHYLTK|HYL|HYLTK|Lsk|MATK
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 56kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- PEALKHGKFTSKSDVWSFGVLLWEVFSYGRAPYPKMSLKEVSEAVEKGYRMEPPEGCPGPVHVLMSSCWEAEPARRPPFRKLAEKLARELRSAGAPASVSGQDADGSTSPRSQEP
- Uniprot:
- P42679
- Synonyme:
- CHK;CSK homologous kinase;Csk-homologous kinase;Csk-type protein tyrosine kinase;CTK;hematopoietic consensus tyrosine-lacking kinase;HHYLTK;hydroxyaryl-protein kinase;HYL;HYL tyrosine kinase;HYLTK;leukocyte carboxyl-terminal src kinase related;Lsk;megakaryocyte-associated tyrosine-protein kinase;protein kinase HYL;tyrosine kinase MATK;tyrosine-protein kinase CTK;tyrosylprotein kinase
- Weitere Details:
- The protein encoded by this gene has amino acid sequence similarity to Csk tyrosine kinase and has the structural features of the CSK subfamily: SRC homology SH2 and SH3 domains, a catalytic domain, a unique N terminus, lack of myristylation signals, lack of a negative regulatory phosphorylation site, and lack of an autophosphorylation site. This protein is thought to play a significant role in the signal transduction of hematopoietic cells. It is able to phosphorylate and inactivate Src family kinases, and may play an inhibitory role in the control of T-cell proliferation. This protein might be involved in signaling in some cases of breast cancer. Three alternatively spliced transcript variants that encode different isoforms have been described for this gene.
- Versandbedingungen:
- Blue Ice