A6648
MAPKAP1 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A6648
- Zusätzliche Namen:
- JC310|MAPKAP1|MIP1|SIN1|SIN1b|SIN1g
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 69kDa/71kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- DGVFEEDSQIDIATVQDMLSSHHYKSFKVSMIHRLRFTTDVQLGISGDKVEIDPVTNQKASTKFWIKQKPISIDSDLLCACDLAEEKSPSHAIFKLTYLSNHDYKHLYFESDAATVNEIVLKVNYILESRASTARADYFAQKQRKLNRRTSFSFQKEKKSGQQ
- Uniprot:
- Q9BPZ7
- Synonyme:
- JC310;MEKK2-interacting protein 1;MIP1;mitogen-activated protein kinase 2-associated protein 1;mitogen-activated protein kinase associated protein 1;mSIN1;ras inhibitor MGC2745;SAPK-interacting protein 1;SIN1;SIN1b;SIN1g;stress-activated map kinase interacting protein 1;Stress-activated map kinase-interacting protein 1;stress-activated protein kinase-interacting 1;target of rapamycin complex 2 subunit MAPKAP1;TORC2 subunit MAPKAP1
- Weitere Details:
- This gene encodes a protein that is highly similar to the yeast SIN1 protein, a stress-activated protein kinase. Alternatively spliced transcript variants encoding distinct isoforms have been described. Alternate polyadenylation sites as well as alternate 3' UTRs have been identified for transcripts of this gene.
- Versandbedingungen:
- Blue Ice