A6596
GALNT3 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A6596
- Zusätzliche Namen:
- GalNAc-T3|GALNT3|HFTC|HFTC1|HHS
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 73kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MAHLKRLVKLHIKRHYHKKFWKLGAVIFFFIIVLVLMQREVSVQYSKEESRMERNMKNKNKMLDLMLEAVNNIKDAMPKMQIGAPVRQNIDAGERPCLQGYYTAAELKPVLDRPPQDSNAPGASGKAFKTTNLSVEEQKE
- Uniprot:
- Q14435
- Synonyme:
- GalNAc transferase 3;GalNAc-T3;HFTC;HFTC1;HHS;polypeptide GalNAc transferase 3;polypeptide GalNAc-transferase T3;polypeptide N-acetylgalactosaminyltransferase 3;pp-GaNTase 3;protein-UDP acetylgalactosaminyltransferase 3;UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 3;UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 3 (GalNAc-T3)
- Weitere Details:
- This gene encodes UDP-GalNAc transferase 3, a member of the GalNAc-transferases family. This family transfers an N-acetyl galactosamine to the hydroxyl group of a serine or threonine residue in the first step of O-linked oligosaccharide biosynthesis. Individual GalNAc-transferases have distinct activities and initiation of O-glycosylation is regulated by a repertoire of GalNAc-transferases. The protein encoded by this gene is highly homologous to other family members, however the enzymes have different substrate specificities.
- Versandbedingungen:
- Blue Ice

