[KO Validated] EEF1B2 Rabbit polyclonal antibody

Größe

Auf Anfrage

SKU:: A6580
Zusätzliche Namen:: B2|EEF1B|EEF1B1|EF1B
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 33kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MGFGDLKSPAGLQVLNDYLADKSYIEGYVPSQADVAVFEAVSSPPPADLCHALRWYNHIKSYEKEKASLPGVKKALGKYGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAKRLREERLAQYESKKAKKPALVAKSSILLDVKPWDDETDMAKLEECVRSIQADGLVWGSSKLVPVGYGIKKLQIQCVVEDDKVGTDMLEEQITAFEDYVQSMDVAAFNKI
Uniprot:: P24534
Synonyme:: EEF1B;EEF1B1;EF-1-beta;EF1B;elongation factor 1-beta;eukaryotic translation elongation factor 1 beta 1
Weitere Details:: This gene encodes a translation elongation factor. The protein is a guanine nucleotide exchange factor involved in the transfer of aminoacylated tRNAs to the ribosome. Alternative splicing results in three transcript variants which differ only in the 5' UTR.