[KO Validated] CIRBP Rabbit polyclonal antibody

Größe

Auf Anfrage

SKU:: A6559
Zusätzliche Namen:: BP|CIRP
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 18kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRGRGRGFSRGGGDRGYGGNRFESRSGGYGGSRDYYSSRSQSGGYSDRSSGGSYRDSYDSYATHNE
Uniprot:: Q14011
Synonyme:: A18 hnRNP;CIRP;cold-inducible RNA-binding protein;glycine-rich RNA binding protein;Glycine-rich RNA-binding protein CIRP;testicular tissue protein Li 39
Weitere Details:: Enables mRNA 3'-UTR binding activity and small ribosomal subunit rRNA binding activity. Involved in mRNA stabilization; positive regulation of translation; and response to UV. Located in cytoplasm and nucleoplasm.