A6539
Calpain small subunit 1 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A6539
- Zusätzliche Namen:
- Calpain small subunit 1|CALPAIN4|CANP|CANPS|CAPN4|CDPS|CSS1
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 28kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- ISEAAAQYNPEPPPPRTHYSNIEANESEEVRQFRRLFAQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKRWQAIYKQFDTDRSGTICSSELPGAFEAAGFHLNEHLYNMIIRRYSDESGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQEWLQLTMYS
- Uniprot:
- P04632
- Synonyme:
- calcium-activated neutral proteinase small subunit;Calcium-dependent protease small subunit;calcium-dependent protease small subunit 1;calcium-dependent protease, small subunit;calpain 4, small subunit (30K);calpain regulatory subunit;calpain small subunit 1;calpain, small polypeptide;CALPAIN4;CANP;CANP small subunit;CANPS;CAPN4;CDPS;CSS1;epididymis secretory sperm binding protein
- Weitere Details:
- This gene is a member of the calpain small subunit family. Calpains are calcium-dependent cysteine proteinases that are widely distributed in mammalian cells. Calpains operate as heterodimers, comprising a specific large catalytic subunit (calpain 1 subunit in Calpain I, and calpain 2 subunit in Calpain II), and a common small regulatory subunit encoded by this gene. This encoded protein is essential for the stability and function of both calpain heterodimers, whose proteolytic activities influence various cellular functions including apoptosis, proliferation, migration, adhesion, and autophagy. Calpains have been implicated in neurodegenerative processes, such as myotonic dystrophy. A pseudogene of this gene has been defined on chromosome 1. Alternative splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice







