A6531
ATP6AP2 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A6531
- Zusätzliche Namen:
- APT6M8-9|ATP6AP2|ATP6IP2|ATP6M8-9|CDG2R|ELDF10|HT028|M8-9|MRXE|MRXSH|MSTP009|PRR|RENR|XMRE|XPDS
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 48kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFEYSVVFNMVLWIMIALALAVIITSYNIWNMDPGYDSIIYRMTNQKIRMD
- Uniprot:
- O75787
- Synonyme:
- APT6M8-9;ATP6IP2;ATP6M8-9;ATPase H(+)-transporting lysosomal accessory protein 2;ATPase H(+)-transporting lysosomal-interacting protein 2;ATPase, H+ transporting, lysosomal (vacuolar proton pump) membrane sector associated protein M8-9;ATPase, H+ transporting, lysosomal accessory protein 2;ATPase, H+ transporting, lysosomal interacting protein 2;CDG2R;ELDF10;embryonic liver differentiation factor 10;ER-localized type I transmembrane adapter;ER-localized type I transmembrane adaptor;HT028;M8-9;MRXE;MRXSH;MSTP009;N14F;prorenin receptor;PRR;renin receptor;renin/prorenin receptor;RENR;V-ATPase M8.9 subunit;vacuolar ATP synthase membrane sector-associated protein M8-9;vacuolar proton ATP synthase membrane sector associated protein M8-9;XMRE;XPDS
- Weitere Details:
- This gene encodes a protein that is associated with adenosine triphosphatases (ATPases). Proton-translocating ATPases have fundamental roles in energy conservation, secondary active transport, acidification of intracellular compartments, and cellular pH homeostasis. There are three classes of ATPases- F, P, and V. The vacuolar (V-type) ATPases have a transmembrane proton-conducting sector and an extramembrane catalytic sector. The encoded protein has been found associated with the transmembrane sector of the V-type ATPases.
- Versandbedingungen:
- Blue Ice

