A6517
AGPAT1 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A6517
- Zusätzliche Namen:
- 1-AGPAT1|AGPAT1|G15|LPAAT-alpha|LPAATA|LPLAT1
- Anwendung:
- ELISA, WB, IP
- Molekulargewicht:
- 32 kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- PIVPIVMSSYQDFYCKKERRFTSGQCQVRVLPPVPTEGLTPDDVPALADRVRHSMLTVFREISTDGRGGGDYLKKPGGGG
- Uniprot:
- Q99943
- Synonyme:
- 1-acyl-sn-glycerol-3-phosphate acyltransferase alpha;1-acylglycerol-3-phosphate O-acyltransferase 1;1-acylglycerol-3-phosphate O-acyltransferase 1 (acetoacetly Coenzyme A thiolase);1-acylglycerol-3-phosphate O-acyltransferase 1 (lysophosphatidic acid acyltransferase, alpha);1-AGP acyltransferase 1;1-AGPAT 1;1-AGPAT1;epididymis secretory sperm binding protein;G15;LPAAT-alpha;LPAATA;lysophosphatidic acid acyltransferase alpha;lysophospholipid acyltransferase;Protein G15
- Weitere Details:
- This gene encodes an enzyme that converts lysophosphatidic acid (LPA) into phosphatidic acid (PA). LPA and PA are two phospholipids involved in signal transduction and in lipid biosynthesis in cells. This enzyme localizes to the endoplasmic reticulum. This gene is located in the class III region of the human major histocompatibility complex. Alternative splicing results in two transcript variants encoding the same protein.
- Versandbedingungen:
- Blue Ice