MARK2 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A6512
Zusätzliche Namen:: EMK-1|EMK1|MARK2|PAR-1|Par-1b|Par1b
Anwendung:: ELISA, WB
Molekulargewicht:: 78kDa/82kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: KPRSLRFTWSMKTTSSMEPNEMMREIRKVLDANSCQSELHEKYMLLCMHGTPGHEDFVQWEMEVCKLPRLSLNGVRFKRISGTSMAFKNIASKIANELKL
Uniprot:: Q7KZI7
Synonyme:: ELKL motif kinase 1;EMK-1;EMK1;MAP/microtubule affinity-regulating kinase 2;PAR-1;Par-1b;PAR1 homolog;PAR1 homolog b;Par1b;Ser/Thr protein kinase PAR-1B;serine/threonine protein kinase EMK;serine/threonine-protein kinase MARK2;testicular tissue protein Li 117
Weitere Details:: This gene encodes a member of the Par-1 family of serine/threonine protein kinases. The protein is an important regulator of cell polarity in epithelial and neuronal cells, and also controls the stability of microtubules through phosphorylation and inactivation of several microtubule-associating proteins. The protein localizes to cell membranes. Multiple transcript variants encoding different isoforms have been found for this gene.