A6496
GNAT1 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A6496
- Zusätzliche Namen:
- CSNB1G|CSNBAD3|GBT1|GNAT1|GNATR|HG1F
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 40kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- SLEECLEFIAIIYGNTLQSILAIVRAMTTLNIQYGDSARQDDARKLMHMADTIEEGTMPKEMSDIIQRLWKDSGIQACFERASEYQLNDSAGYYLSDLERLVTPGYVPTEQDVLRSRVKTT
- Uniprot:
- P11488
- Synonyme:
- CSNB1G;CSNBAD3;GBT1;GNATR;guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 1;guanine nucleotide-binding protein G(t) subunit alpha-1;guanine nucleotide-binding protein G(T), alpha-1 subunit;rod-type transducin alpha subunit;transducin alpha-1 chain;transducin, rod-specific
- Weitere Details:
- Transducin is a 3-subunit guanine nucleotide-binding protein (G protein) which stimulates the coupling of rhodopsin and cGMP-phoshodiesterase during visual impulses. The transducin alpha subunits in rods and cones are encoded by separate genes. This gene encodes the alpha subunit in rods. This gene is also expressed in other cells, and has been implicated in bitter taste transduction in rat taste cells. Mutations in this gene result in autosomal dominant congenital stationary night blindness. Multiple alternatively spliced variants, encoding the same protein, have been identified.
- Versandbedingungen:
- Blue Ice

