A6485
UCN2 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A6485
- Zusätzliche Namen:
- SRP|UCN-II|UCN2|UCNI|UR|URP
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 12kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- VPVTPIPTFQLRPQNSPQTTPRPAASESPSAAPTWPWAAQSHCSPTRHPGSRIVLSLDVPIGLLQILLEQARARAAREQATTNARILARVGHC
- Uniprot:
- Q96RP3
- Synonyme:
- prepro-urocortin 2;SRP;stresscopin-related peptide;ucn II;UCN-II;UCNI;UR;urocortin II;urocortin-2;urocortin-related peptide;URP
- Weitere Details:
- This gene is a member of the sauvagine/corticotropin-releasing factor/urotensin I family. It is structurally related to the corticotropin-releasing factor (CRF) gene and the encoded product is an endogenous ligand for CRF type 2 receptors. In the brain it may be responsible for the effects of stress on appetite. In spite of the gene family name similarity, the product of this gene has no sequence similarity to urotensin II.
- Versandbedingungen:
- Blue Ice