LNX1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A6481
Zusätzliche Namen:: LNX|LNX1|MPDZ|PDZRN2
Anwendung:: ELISA, WB
Molekulargewicht:: 75kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: ITCHEKVVNIQKDPGESLGMTVAGGASHREWDLPIYVISVEPGGVISRDGRIKTGDILLNVDGVELTEVSRSEAVALLKRTSSSIVLKALEVKE
Uniprot:: Q8TBB1
Synonyme:: E3 ubiquitin-protein ligase LNX;Ligand of Numb-protein X 1;ligand of numb-protein X 1, E3 ubiquitin protein ligase;LNX;MPDZ;multi-PDZ-domain-containing protein, E3 ubiquitin-protein ligase LNX;numb-binding protein 1;PDZ domain-containing ring finger protein 2;PDZRN2;RING-type E3 ubiquitin transferase LNX
Weitere Details:: This gene encodes a membrane-bound protein that is involved in signal transduction and protein interactions. The encoded product is an E3 ubiquitin-protein ligase, which mediates ubiquitination and subsequent proteasomal degradation of proteins containing phosphotyrosine binding (PTB) domains. This protein may play an important role in tumorogenesis. Alternatively spliced transcript variants encoding distinct isoforms have been described. A pseudogene, which is located on chromosome 17, has been identified for this gene.