PHC3 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A6479
Zusätzliche Namen:: EDR3|HPH3|PHC3
Anwendung:: ELISA, WB
Molekulargewicht:: 106kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: LSSSQLQSLAAVQASLSSGRPSTSPTGSVTQQSSMSQTSINLSTSPTPAQLISRSQASSSTSGSITQQTMLLGSTSPTLTASQAQMYLRAQMLIFTPATTVAAVQSDIPVVSSSSSSSCQSAATQVQNLTLRSQKLGVLSSSQNGPPKSTSQTQSLTICHNKTTVTSSKISQRDPSPESNKKGESPSLESRSTAVTRTSSI
Uniprot:: Q8NDX5
Synonyme:: early development regulator 3;early development regulatory protein 3;EDR3;homolog of polyhomeotic 3;HPH3;polyhomeotic like 3;polyhomeotic-like protein 3
Weitere Details:: Predicted to enable chromatin binding activity and histone binding activity. Predicted to be involved in negative regulation of transcription, DNA-templated. Located in nucleoplasm. Part of PRC1 complex.