[KO Validated] NRBF2 Rabbit polyclonal antibody

Größe

Auf Anfrage

SKU:: A6462
Zusätzliche Namen:: COPR|COPR1|COPR2|F2|NRBF-2
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 38kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MEVMEGPLNLAHQQSRRADRLLAAGKYEEAISCHKKAAAYLSEAMKLTQSEQAHLSLELQRDSHMKQLLLIQERWKRAQREERLKAQQNTDKDAAAHLQTSHKPSAEDAEGQSPLSQKYSPSTEKCLPEIQGIFDRDPDTLLYLLQQKSEPAEPCIGSKAPKDDKTIIEEQATKIADLKRHVEFLVAENERLRKENKQLKAEKARLLKGPIEKELDVDADFVETSELWSLPPHAETATASSTWQKFAANTGKAKDIPIPNLPPLDFPSPELPLMELSEDILKGFMNN
Uniprot:: Q96F24
Synonyme:: Comodulator of PPAR and RXR;comodulator of PPAR and RXR 1;comodulator of PPAR and RXR 2;COPR;COPR1;COPR2;NRBF-2;nuclear receptor-binding factor 2
Weitere Details:: Involved in autophagy. Located in cytoplasm. Colocalizes with phosphatidylinositol 3-kinase complex, class III.