A6443
RNF40 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A6443
- Zusätzliche Namen:
- BRE1B|RBP95|RNF40|STARING
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 130kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MSGPGNKRAAGDGGSGPPEKKLSREEKTTTTLIEPIRLGGISSTEEMDLKVLQFKNKKLAERLEQRQACEDELRERIEKLEKRQATDDATLLIVNRYWAQLDETVEALLRCHESQGELSSAPEAPGTQEGPTCDGTPLPEPGTSELRDPLLMQLRPPLSEPALAFVVALGASSSEEVELELQGRMEFSKAAVSRVVEASDRLQRRVEELCQRVYSRGDSEPLSEAAQAHTRELGRENRRLQDLATQLQEKHHRISLEYSELQDKVTSAETKVLEMETTVEDLQWDIEKLRKREQKLNKHL
- Uniprot:
- O75150
- Synonyme:
- 95 kDa retinoblastoma protein binding protein;95 kDa retinoblastoma-associated protein;BRE1 E3 ubiquitin ligase homolog B;BRE1-B;BRE1B;E3 ubiquitin-protein ligase BRE1B;Rb-associated protein;RBP95;RING finger protein 40;ring finger protein 40, E3 ubiquitin protein ligase;RING-type E3 ubiquitin transferase BRE1B;STARING
- Weitere Details:
- The protein encoded by this gene contains a RING finger, a motif known to be involved in protein-protein and protein-DNA interactions. This protein was reported to interact with the tumor suppressor protein RB1. Studies of the rat counterpart suggested that this protein may function as an E3 ubiquitin-protein ligase, and facilitate the ubiquitination and degradation of syntaxin 1, which is an essential component of the neurotransmitter release machinery. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice

