[KO Validated] C21orf33 Rabbit polyclonal antibody

Größe

Auf Anfrage

SKU:: A6429
Zusätzliche Namen:: 33|C21orf33|ES1|GATD3A|GT335|HES1|KNPH|KNPI
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 25kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: AARVALVLSGCGVYDGTEIHEASAILVHLSRGGAEVQIFAPDVPQMHVIDHTKGQPSEGESRNVLTESARIARGKITDLANLSAANHDAAIFPGGFGAAKNLSTFAVDGKDCKVNKEVERVLKEFHQAGKPIGLCCIAPVLAAKVLRGVEVTVGHEQEEGGKWPYAGTAEAIKALGAKHCVKEVVEAHVDQKNKVVTTPAFMCETALHYIHDGIGAMVRKVLELTGK
Uniprot:: P30042
Synonyme:: C21orf33;ES1;ES1 protein homolog, mitochondrial;GATD3A;GATD3B;glutamine amidotransferase class 1 domain containing 3A;glutamine amidotransferase like class 1 domain containing 3A;glutamine amidotransferase like class 1 domain containing 3B;glutamine amidotransferase-like class 1 domain-containing protein 3A, mitochondrial;glutamine amidotransferase-like class 1 domain-containing protein 3B, mitochondrial;GT335;HES1;human HES1 protein, homolog to E.coli and zebrafish ES1 protein;Keio novel protein I;keio novel protein-I;KNP-I;KNPH;KNPI;Protein GT335;Protein HES1;Protein KNP-I;testis secretory sperm-binding protein Li 237E
Weitere Details:: This gene encodes a potential mitochondrial protein that is a member of the DJ-1/PfpI gene family. This protein is overexpressed in fetal Down syndrome brain. Alternate splicing results in multiple transcript variants.

Versandbedingungen:: Blue Ice