A6429
[KO Validated] C21orf33 Rabbit polyclonal antibody

Größe
Auf Anfrage
- SKU:
- A6429
- Zusätzliche Namen:
- 33|C21orf33|ES1|GATD3A|GT335|HES1|KNPH|KNPI
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 25kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- AARVALVLSGCGVYDGTEIHEASAILVHLSRGGAEVQIFAPDVPQMHVIDHTKGQPSEGESRNVLTESARIARGKITDLANLSAANHDAAIFPGGFGAAKNLSTFAVDGKDCKVNKEVERVLKEFHQAGKPIGLCCIAPVLAAKVLRGVEVTVGHEQEEGGKWPYAGTAEAIKALGAKHCVKEVVEAHVDQKNKVVTTPAFMCETALHYIHDGIGAMVRKVLELTGK
- Uniprot:
- P30042
- Synonyme:
- C21orf33;ES1;ES1 protein homolog, mitochondrial;GATD3A;GATD3B;glutamine amidotransferase class 1 domain containing 3A;glutamine amidotransferase like class 1 domain containing 3A;glutamine amidotransferase like class 1 domain containing 3B;glutamine amidotransferase-like class 1 domain-containing protein 3A, mitochondrial;glutamine amidotransferase-like class 1 domain-containing protein 3B, mitochondrial;GT335;HES1;human HES1 protein, homolog to E.coli and zebrafish ES1 protein;Keio novel protein I;keio novel protein-I;KNP-I;KNPH;KNPI;Protein GT335;Protein HES1;Protein KNP-I;testis secretory sperm-binding protein Li 237E
- Weitere Details:
- This gene encodes a potential mitochondrial protein that is a member of the DJ-1/PfpI gene family. This protein is overexpressed in fetal Down syndrome brain. Alternate splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice
![[KO Validated] C21orf33 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A6429/A6429_1.jpg)
![[KO Validated] C21orf33 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A6429/A6429_2.jpg)
![[KO Validated] C21orf33 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A6429/A6429_P2126_KO-WB_01.jpg)
![[KO Validated] C21orf33 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A6429/A6429_P2125_IF_01.jpg)