NR2C2 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A6422
Zusätzliche Namen:: NR2C2|TAK1|TR4
Anwendung:: ELISA, WB
Molekulargewicht:: 67kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: LIATPTFVADKDGARQTGLLDPGMLVNIQQPLIREDGTVLLATDSKAETSQGALGTLANVVTSLANLSESLNNGDTSEIQPEDQSASEITRAFDTLAKALNTTDSSSSPSLADGIDTSGGGSIHVISRDQSTPIIEVEGPL
Uniprot:: P49116
Synonyme:: Nuclear hormone receptor TR4;nuclear receptor subfamily 2 group C member 2;orphan nuclear receptor TAK1;orphan nuclear receptor TR4;orphan receptor TR4;TAK1;testicular nuclear receptor 4;Testicular receptor 4;TR4
Weitere Details:: This gene encodes a protein that belongs to the nuclear hormone receptor family. Members of this family act as ligand-activated transcription factors and function in many biological processes such as development, cellular differentiation and homeostasis. The activated receptor/ligand complex is translocated to the nucleus where it binds to hormone response elements of target genes. The protein encoded by this gene plays a role in protecting cells from oxidative stress and damage induced by ionizing radiation. The lack of a similar gene in mouse results in growth retardation, severe spinal curvature, subfertility, premature aging, and prostatic intraepithelial neoplasia (PIN) development. Alternative splicing results in multiple transcript variants encoding different isoforms.

Versandbedingungen:: Blue Ice