A6417
TSPAN7 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A6417
- Zusätzliche Namen:
- A15|CCG-B7|CD231|DXS1692E|MRX58|MXS1|TALLA-1|TM4SF2|TM4SF2b|TSPAN7|XLID58
- Anwendung:
- ELISA, WB, IF
- Molekulargewicht:
- 28kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- AVDHVQRSLSCCGVQNYTNWSTSPYFLEHGIPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFMETNMGIIAGVAFGIAFSQLIGMLLACCLSRF
- Uniprot:
- P41732
- Synonyme:
- A15;CCG-B7;CD231;CD231 antigen;cell surface glycoprotein A15;DXS1692E;membrane component chromosome X surface marker 1;membrane component, X chromosome, surface marker 1;MRX58;MXS1;T-cell acute lymphoblastic leukemia associated antigen 1;T-cell acute lymphoblastic leukemia-associated antigen 1;TALLA-1;tetraspanin protein;tetraspanin-7;TM4SF2;TM4SF2b;transmembrane 4 superfamily 2b;transmembrane 4 superfamily member 2;transmembrane protein A15;tspan-7;XLID58
- Weitere Details:
- The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein and may have a role in the control of neurite outgrowth. It is known to complex with integrins. This gene is associated with X-linked cognitive disability and neuropsychiatric diseases such as Huntington's chorea, fragile X syndrome and myotonic dystrophy.
- Versandbedingungen:
- Blue Ice