KLK10 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A6398
Zusätzliche Namen:: KLK10|NES1|PRSSL1
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 30kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: LDPEAYGSPCARGSQPWQVSLFNGLSFHCAGVLVDQSWVLTAAHCGNKPLWARVGDDHLLLLQGEQLRRTTRSVVHPKYHQGSGPILPRRTDEHDLMLLKLARPVVLGPRVRALQLPYRCAQPGDQCQVAGWGTTAARRVKYNKGLTCSSITILSPKECEVFYPGVVTNNMICAGLDRGQDPCQSDSGGPLVCDETLQGILSWGVYPCGSAQHPAVYTQICKYMSWINKVIRSN
Uniprot:: O43240
Synonyme:: breast normal epithelial cell associated serine protease;kallikrein 10 protein 1;kallikrein 10 protein 12;kallikrein 10 protein 13;kallikrein 10 protein 2;kallikrein 10 protein 3;kallikrein 10 protein 4;kallikrein 10 protein 5;kallikrein 10 protein 7;kallikrein 10 protein 8;kallikrein 10 protein 9;kallikrein-10;NES1;normal epithelial cell-specific 1;protease serine-like 1;PRSSL1
Weitere Details:: Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Its encoded protein is secreted and may play a role in suppression of tumorigenesis in breast and prostate cancers. Alternate splicing of this gene results in multiple transcript variants encoding the same protein.

Versandbedingungen:: Blue Ice