SERPINB9 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A6393
Zusätzliche Namen:: CAP-3|CAP3|PI-9|PI9|SERPINB9
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 42kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: KWNEPFDETYTREMPFKINQEEQRPVQMMYQEATFKLAHVGEVRAQLLELPYARKELSLLVLLPDDGVELSTVEKSLTFEKLTAWTKPDCMKSTEVEVLLPKFKLQEDYDMESVLRHLGIVDAFQQGKADLSAMSAERD
Uniprot:: P50453
Synonyme:: CAP-3;CAP3;cytoplasmic antiproteinase 3;peptidase inhibitor 9;PI-9;PI9;protease inhibitor 9 (ovalbumin type);serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 9;serpin B9;serpin peptidase inhibitor, clade B (ovalbumin), member 9;serpin peptidase inhibitor, clade B, member 9;testicular tissue protein Li 180
Weitere Details:: This gene encodes a member of the serine protease inhibitor family which are also known as serpins. The encoded protein belongs to a subfamily of intracellular serpins. This protein inhibits the activity of the effector molecule granzyme B. Overexpression of this protein may prevent cytotoxic T-lymphocytes from eliminating certain tumor cells. A pseudogene of this gene is found on chromosome 6.