A6385
LIPA Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A6385
- Zusätzliche Namen:
- CESD|LAL|LIPA
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 40-45kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- DAGFDVWMGNSRGNTWSRKHKTLSVSQDEFWAFSYDEMAKYDLPASINFILNKTGQEQVYYVGHSQGTTIGFIAFSQIPELAKRIKMFFALGPVASVAFCTSPMAKLGRLPDHLIKDLFGDKEFLPQSAFLKWLGTHVCTHVILKELCGNLCFLLCGFNERNLNMSRVDVYTTHSPAGTSVQNMLHWSQAVKFQKFQAFDWGSSAKNYFHYNQSYPPTYNVKDMLVPTAVWSGGHDWLADVYDVNILLTQITNLVFHESIPEWEHLDFIWGLDAPWRLYNKIINLMRKYQ
- Uniprot:
- P38571
- Synonyme:
- acid cholesteryl ester hydrolase;CESD;cholesterol ester hydrolase;cholesteryl esterase;LAL;Lipase A;lipase A, lysosomal acid, cholesterol esterase;lysosomal acid lipase;lysosomal acid lipase/cholesteryl ester hydrolase;sterol esterase
- Weitere Details:
- This gene encodes lipase A, the lysosomal acid lipase (also known as cholesterol ester hydrolase). This enzyme functions in the lysosome to catalyze the hydrolysis of cholesteryl esters and triglycerides. Mutations in this gene can result in Wolman disease and cholesteryl ester storage disease. Alternatively spliced transcript variants have been found for this gene.
- Versandbedingungen:
- Blue Ice