A6380
Gastrin Releasing Peptide (GRP) Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A6380
- Zusätzliche Namen:
- BN|Gastrin Releasing Peptide (GRP)|GRP-10|preproGRP|proGRP
- Anwendung:
- ELISA, WB, IHC-P, IF, ICC
- Molekulargewicht:
- 16Kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MRGRELPLVLLALVLCLAPRGRAVPLPAGGGTVLTKMYPRGNHWAVGHLMGKKSTGESSSVSERGSLKQQLREYIRWEEAARNLLGLIEAKENRNHQPPQPKALGNQQPSWDSEDSSNFKDVGSKGKVGRLSAPGSQREGRNPQLNQQ
- Uniprot:
- P07492
- Synonyme:
- BN;bombesin;gastrin-releasing peptide;GRP-10;neuromedin C;pre-progastrin releasing peptide;prepro-GRP;preproGRP;proGRP;testicular tissue protein Li 103
- Weitere Details:
- This gene encodes a member of the bombesin-like family of gastrin-releasing peptides. The encoded preproprotein is proteolytically processed to generate two peptides, gastrin-releasing peptide and neuromedin-C. These peptides regulate numerous functions of the gastrointestinal and central nervous systems, including release of gastrointestinal hormones, smooth muscle cell contraction, and epithelial cell proliferation. These peptides are also likely to play a role in human cancers of the lung, colon, stomach, pancreas, breast, and prostate. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed.
- Versandbedingungen:
- Blue Ice