A6374
FGF9 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A6374
- Zusätzliche Namen:
- FGF-9|FGF9|GAF|HBFG-9|HBGF-9|SYNS3
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 55kDa/23kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MAPLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISI
- Uniprot:
- P31371
- Synonyme:
- FGF-9;fibroblast growth factor 9;fibroblast growth factor 9 (glia-activating factor);GAF;Glia-activating factor;HBFG-9;HBGF-9;heparin-binding growth factor 9;SYNS3
- Weitere Details:
- The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein was isolated as a secreted factor that exhibits a growth-stimulating effect on cultured glial cells. In nervous system, this protein is produced mainly by neurons and may be important for glial cell development. Expression of the mouse homolog of this gene was found to be dependent on Sonic hedgehog (Shh) signaling. Mice lacking the homolog gene displayed a male-to-female sex reversal phenotype, which suggested a role in testicular embryogenesis.
- Versandbedingungen:
- Blue Ice



