A6363
CLIC1 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A6363
- Zusätzliche Namen:
- CL1C1|CLCNL1|CLIC1|G6|NCC27
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 27kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- NVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK
- Uniprot:
- O00299
- Synonyme:
- chloride channel ABP;chloride intracellular channel protein 1;CL1C1;CLCNL1;G6;hRNCC;NCC27;nuclear chloride ion channel 27;nuclear chloride ion channel protein;p64CLCP;regulatory nuclear chloride ion channel protein;RNCC protein
- Weitere Details:
- Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 1 is a member of the p64 family; the protein localizes principally to the cell nucleus and exhibits both nuclear and plasma membrane chloride ion channel activity.
- Versandbedingungen:
- Blue Ice

