A6341
CANT1 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A6341
- Zusätzliche Namen:
- CANT1|DBQD|DBQD1|EDM7|SCAN-1|SCAN1|SHAPY
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 45kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- HRPAPGRPPTHNAHNWRLGQAPANWYNDTYPLSPPQRTPAGIRYRIAVIADLDTESRAQEENTWFSYLKKGYLTLSDSGDKVAVEWDKDHGVLESHLAEKGRGMELSDLIVFNGKLYSVDDRTGVVYQIEGSKAVPWVILSDGDGTVEKGFKAEWLAVKDERLYVGGLGK
- Uniprot:
- Q8WVQ1
- Synonyme:
- apyrase 1 homolog (C. lectularius);apyrase homolog;Ca2+-dependent endoplasmic reticulum nucleoside diphosphatase;DBQD;DBQD1;EDM7;micromelic dwarfism with vertebral and metaphyseal abnormalities and advanced carpotarsal ossification;putative MAPK-activating protein PM09;putative NF-kappa-B-activating protein 107;SCAN-1;SCAN1;SHAPY;soluble Ca-activated nucleotidase, isozyme 1;soluble calcium-activated nucleotidase 1;soluble calcium-activated nucleotidase SCAN-1
- Weitere Details:
- This protein encoded by this gene belongs to the apyrase family. It functions as a calcium-dependent nucleotidase with a preference for UDP. Mutations in this gene are associated with Desbuquois dysplasia with hand anomalies. Alternatively spliced transcript variants have been noted for this gene.
- Versandbedingungen:
- Blue Ice

