BCAP29 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A6335
Zusätzliche Namen:: B29|BAP29|BCAP29
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 28kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: TQLAKELSNKGVLKTQAENTNKAAKKFMEENEKLKRILKSHGKDEECVLEAENKKLVEDQEKLKTELRKTSDALSKAQNDVMEMKMQSERLSKEYDQLLKEHSELQDRLERGNKKRL
Uniprot:: Q9UHQ4
Synonyme:: B-cell receptor-associated protein 29;BAP29;BCR-associated protein 29
Weitere Details:: Involved in osteoblast differentiation. Located in membrane.