A6329
Peroxiredoxin 5 (PRDX5) Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A6329
- Zusätzliche Namen:
- ACR1|AOEB166|B166|HEL-S-55|Peroxiredoxin 5 (PRDX5)|PLP|PMP20|PRDX6|prx-V|PRXV|SBBI10
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 17kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MAPIKVGDAIPAVEVFEGEPGNKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGVQVVACLSVNDAFVTGEWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPNIISQL
- Uniprot:
- P30044
- Synonyme:
- ACR1;Alu co-repressor 1;Alu corepressor 1;antioxidant enzyme B166;AOEB166;B166;epididymis secretory protein Li 55;HEL-S-55;liver tissue 2D-page spot 71B;peroxiredoxin V;peroxiredoxin-5, mitochondrial;peroxisomal antioxidant enzyme;PLP;PMP20;PRDX6;prx-V;PRXV;SBBI10;thioredoxin peroxidase PMP20;thioredoxin reductase;thioredoxin-dependent peroxiredoxin 5;TPx type VI
- Weitere Details:
- This gene encodes a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein interacts with peroxisome receptor 1 and plays an antioxidant protective role in different tissues under normal conditions and during inflammatory processes. The use of alternate transcription start sites is thought to result in transcript variants that use different in-frame translational start codons to generate isoforms that are targeted to the mitochondrion (isoform L) or peroxisome/cytoplasm (isoform S). Multiple related pseudogenes have been defined for this gene.
- Versandbedingungen:
- Blue Ice