A6326
SIVA1 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A6326
- Zusätzliche Namen:
- CD27BP|SIVA|Siva-1|Siva-2|SIVA1
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 15kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MPKRSCPFADVAPLQLKVRVSQRELSRGVCAERYSQEVFDPSGVASIACSSCVRAVDGKAVCGQCERALCGQCVRTCWGCGSVACTLCGLVDCSDMYEKVLCTSCAMFET
- Uniprot:
- O15304
- Synonyme:
- apoptosis regulatory protein Siva;CD27-binding (Siva) protein;CD27-binding protein;CD27BP;SIVA;Siva-1;Siva-2
- Weitere Details:
- This gene encodes an E3 ubiquitin ligase that regulates cell cycle progression, cell proliferation and apoptosis. The N-terminus of this protein binds to the cytoplasmic tail of the CD27 antigen, a member of the tumor necrosis factor receptor (TNFR) superfamily. In response to UV radiation-induced DNA damage, this protein has been shown to mediate the ubiquitination of proliferating cell nuclear antigen (PCNA), an important step in translesion DNA synthesis.
- Versandbedingungen:
- Blue Ice