CFDP1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A6325
Zusätzliche Namen:: BCNT|BUCENTAUR|CENP-29|CFDP1|CP27|p97|SWC5|Yeti
Anwendung:: ELISA, WB
Molekulargewicht:: 33kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MEEFDSEDFSTSEEDEDYVPSGGEYSEDDVNELVKEDEVDGEEQTQKTQGKKRKAQSIPARKRRQGGLSLEEEEEEDANSESEGSSSEEEDDAAEQEKGIGSEDARKKKEDELWASFLNDVGPKSKVPPSTQVKKGEETEETSSSKLLVKAEELEKPKETEKVKITKVFDFAGEEVRVTKEVDATSKEAKSFFKQNEKEKPQANVPSALPSLPAGSGLKRSSGMSSLLGKIGAKKQKMSTLEKSKLDWESFKEEEGIGEELAIHNRGKEGYIERKAFLDRVDHRQFEIERDLRLSKMKP
Uniprot:: Q9UEE9
Synonyme:: BCNT;BUCENTAUR;CENP-29;centromere protein 29;CP27;craniofacial development protein 1;p97;phosphoprotein (Bucentaur);SWC5;Yeti
Weitere Details:: Predicted to act upstream of or within several processes, including cell adhesion; negative regulation of fibroblast apoptotic process; and regulation of cell shape. Predicted to be located in kinetochore.