SOAT1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A6311
Zusätzliche Namen:: ACACT|ACAT|ACAT-1|ACAT1|SOAT|SOAT1|STAT
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 55 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
ABP:: No Import Docs
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MVGEEKMSLRNRLSKSRENPEEDEDQRNPAKESLETPSNGRIDIKQLIAKKIKLTAEAEELKPFFMKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSVLEGEKNNHRAKDLRAPPEQGKIFIARRSLLD
Uniprot:: P35610
Synonyme:: ACACT;ACAT;ACAT-1;ACAT1;acyl-coenzyme A:cholesterol acyltransferase 1;Cholesterol acyltransferase 1;SOAT;STAT;sterol O-acyltransferase (acyl-Coenzyme A: cholesterol acyltransferase) 1;sterol O-acyltransferase 1
Weitere Details:: The protein encoded by this gene belongs to the acyltransferase family. It is located in the endoplasmic reticulum, and catalyzes the formation of fatty acid-cholesterol esters. This gene has been implicated in the formation of beta-amyloid and atherosclerotic plaques by controlling the equilibrium between free cholesterol and cytoplasmic cholesteryl esters. Alternatively spliced transcript variants have been found for this gene.