MPP1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A6298
Zusätzliche Namen:: AAG12|DXS552E|EMP55|MPP1|MRG1|PEMP
Anwendung:: ELISA, WB
Molekulargewicht:: 52kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MTLKASEGESGGSMHTALSDLYLEHLLQKRSRPEAVSHPLNTVTEDMYTNGSPAPGSPAQVKGQEVRKVRLIQFEKVTEEPMGITLKLNEKQSCTVARILHGGMIHRQGSLHVGDEILEINGTNVTNHSVDQLQKAMKETKGMISLKVIPNQQSRLPALQMFMRAQFDYDPKKDNLIPCKEAGLKFATGDIIQIINKDDSNWWQGRVEGSSKESAGLIPSPELQEWRVASMAQSAPSEAPSCSPFGKKKKYKDKYLAKHSSIFDQLDVVS
Uniprot:: Q00013
Synonyme:: 55 kDa erythrocyte membrane protein;AAG12;aging-associated gene 12;DXS552E;EMP55;erythrocyte membrane protein p55;membrane palmitoylated protein 1;Membrane protein, palmitoylated 1;membrane protein, palmitoylated 1, 55kDa;migration-related gene 1;MRG1;p55;palmitoylated erythrocyte membrane protein;PEMP
Weitere Details:: This gene encodes the prototype of the membrane-associated guanylate kinase (MAGUK) family proteins. MAGUKs interact with the cytoskeleton and regulate cell proliferation, signaling pathways, and intercellular junctions. The encoded protein is an extensively palmitoylated membrane phosphoprotein containing a PDZ domain, a Src homology 3 (SH3) motif, and a guanylate kinase domain. This gene product interacts with various cytoskeletal proteins and cell junctional proteins in different tissue and cell types, and may be involved in the regulation of cell shape, hair cell development, neural patterning of the retina, and apico-basal polarity and tumor suppression pathways in non-erythroid cells. Multiple transcript variants encoding different isoforms have been found for this gene.

Versandbedingungen:: Blue Ice