SERPINB1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A6257
Zusätzliche Namen:: EI|ELANH2|HEL-S-27|HEL57|LEI|M/NEI|MNEI|PI-2|PI2|SERPINB1
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 45kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: FLPEFLVSTQKTYGADLASVDFQHASEDARKTINQWVKGQTEGKIPELLASGMVDNMTKLVLVNAIYFKGNWKDKFMKEATTNAPFRLNKKDRKTVKMMYQKKKFAYGYIEDLKCRVLELPYQGEELSMVILLPDDIEDESTGLKKIEEQLTLEKLHEWTKPENLDFIEVNVSLPRFKLEESYTLNSDLARLGVQDLFNSSKADLSGMSGARDIFISKIVHKSFVEVNEEGTEAAAATAGIATFCMLMPEENFTADHPFLFFIRHNSSGSILFLGRFSSP
Uniprot:: P30740
Synonyme:: EI;ELANH2;epididymis luminal protein 57;epididymis secretory protein Li 27;HEL-S-27;HEL57;LEI;leukocyte elastase inhibitor;M/NEI;MNEI;Monocyte/neutrophil elastase inhibitor;peptidase inhibitor 2;PI-2;PI2;protease inhibitor 2 (anti-elastase), monocyte/neutrophil derived;serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 1;Serpin B1;serpin peptidase inhibitor, clade B (ovalbumin), member 1
Weitere Details:: The protein encoded by this gene is a member of the serpin family of proteinase inhibitors. Members of this family maintain homeostasis by neutralizing overexpressed proteinase activity through their function as suicide substrates. This protein inhibits the neutrophil-derived proteinases neutrophil elastase, cathepsin G, and proteinase-3 and thus protects tissues from damage at inflammatory sites. Alternative splicing results in multiple transcript variants.

Versandbedingungen:: Blue Ice