CYP51A1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A6252
Zusätzliche Namen:: CP51|CYP51|CYP51A1|CYPL1|LDM|P450-14DM|P450L1
Anwendung:: ELISA, WB
Molekulargewicht:: 57kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: LTASHCLHGKEIRSQLNEKVAQLYADLDGGFSHAAWLLPGWLPLPSFRRRDRAHREIKDIFYKAIQKRRQSQEKIDDILQTLLDATYKDGRPLTDDEVAGMLIGLLLAGQHTSSTTSAWMGFFLARDKTLQKKCYLEQKTVCGENLPPLTYDQLKDLNLLDRCIKETLRLRPPIMIMMRMARTPQTVAGYTIPPGHQVCVSPTVNQRLKDSWVERLDFNPDRYLQDNPASGEKFAYVPFGAGRHRCIGENFAYVQIKTIWSTMLRLYEFDLIDGYFPTVNYTTMIHTPENPVIRYKRRSK
Uniprot:: Q16850
Synonyme:: CP51;CYP51;CYPL1;CYPLI;cytochrome P450 51A1;cytochrome P450-14DM;cytochrome P450, 51 (lanosterol 14-alpha-demethylase);cytochrome P450, family 51, subfamily A, polypeptide 1;cytochrome P45014DM;cytochrome P450LI;lanosterol 14-alpha demethylase;LDM;P450-14DM;P450L1;sterol 14-alpha demethylase
Weitere Details:: This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This endoplasmic reticulum protein participates in the synthesis of cholesterol by catalyzing the removal of the 14alpha-methyl group from lanosterol. Homologous genes are found in all three eukaryotic phyla, fungi, plants, and animals, suggesting that this is one of the oldest cytochrome P450 genes. Two transcript variants encoding different isoforms have been found for this gene.

Versandbedingungen:: Blue Ice