A6251
COG2 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A6251
- Zusätzliche Namen:
- CDG2Q|COG2|LDLC
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 88kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MEKSRMNLPKGPDTLCFDKDEFMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGMDKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMSKQEDIRKKKMCVLRLIQVIRSVEKIEKILNSQSSKETSALEASSPLLTGQILERIATEFNQLQFHAVQSKGMPLLDKVRPRIAGITAMLQQSLEGLLLEGLQTSDVDIIRHCLRTYATIDKTRDAEALVGQVLVKPYIDEVIIEQFVESHPNGLQVMYNKLL
- Uniprot:
- Q14746
- Synonyme:
- brefeldin A-sensitive, peripheral Golgi protein;CDG2Q;COG complex subunit 2;Component of oligomeric Golgi complex 2;conserved oligomeric Golgi complex protein 2;conserved oligomeric Golgi complex subunit 2;LDLC;low density lipoprotein receptor defect C complementing;low density lipoprotein receptor defect C-complementing protein
- Weitere Details:
- This gene encodes a subunit of the conserved oligomeric Golgi complex that is required for maintaining normal structure and activity of the Golgi complex. The encoded protein specifically interacts with the USO1 vesicle docking protein and may be necessary for normal Golgi ribbon formation and trafficking of Golgi enzymes. Mutations of this gene are associated with abnormal glycosylation within the Golgi apparatus. Alternative splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice





