A6248
GAB1 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A6248
- Zusätzliche Namen:
- DFNB26|GAB1
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 110kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- PNLSSEDPNLFGSNSLDGGSSPMIKPKGDKQVEYLDLDLDSGKSTPPRKQKSSGSGSSVADERVDYVVVDQQKTLALKSTREAWTDGRQSTESETPAKSVK
- Uniprot:
- Q13480
- Synonyme:
- deafness, autosomal recessive 26;DFNB26;GRB2-associated binder 1;GRB2-associated-binding protein 1;growth factor receptor bound protein 2-associated protein 1;symbol withdrawn, see GAB1
- Weitere Details:
- The protein encoded by this gene is a member of the IRS1-like multisubstrate docking protein family. It is an important mediator of branching tubulogenesis and plays a central role in cellular growth response, transformation and apoptosis. Two transcript variants encoding different isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice