A6231
GZMA Rabbit polyclonal antibody
Größe
Auf Anfrage
- SKU:
- A6231
- Zusätzliche Namen:
- CTLA3|GZMA|HFSP
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 28kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- IIGGNEVTPHSRPYMVLLSLDRKTICAGALIAKDWVLTAAHCNLNKRSQVILGAHSITREEPTKQIMLVKKEFPYPCYDPATREGDLKLLQLMEKAKINKYVTILHLPKKGDDVKPGTMCQVAGWGRTHNSASWSDTLREVNITIIDRKVCNDRNHYNFNPVIGMNMVCAGSLRGGRDSCNGDSGSPLLCEGVFRGVTSFGLENKCGDPRGPGVYILLSKKHLNWIIMTIKGAV
- Uniprot:
- P12544
- Synonyme:
- CTL tryptase;CTLA3;cytotoxic T-lymphocyte proteinase 1;Cytotoxic T-lymphocyte-associated serine esterase-3;fragmentin-1;granzyme 1;granzyme A;Granzyme A (Cytotoxic T-lymphocyte-associated serine esterase-3; Hanukah factor serine protease);granzyme A (granzyme 1, cytotoxic T-lymphocyte-associated serine esterase 3);Granzyme-1;h factor;Hanukah factor serine protease);Hanukkah factor;HF;HFSP
- Weitere Details:
- Cytolytic T lymphocytes (CTL) and natural killer (NK) cells share the remarkable ability to recognize, bind, and lyse specific target cells. They are thought to protect their host by lysing cells bearing on their surface 'nonself' antigens, usually peptides or proteins resulting from infection by intracellular pathogens. The protein described here is a T cell- and natural killer cell-specific serine protease that may function as a common component necessary for lysis of target cells by cytotoxic T lymphocytes and natural killer cells.
- Versandbedingungen:
- Blue Ice