IL22 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A6216
Zusätzliche Namen:: IL-21|IL-22|IL-D110|IL-TIF|IL22|ILTIF|TIFa|TIFIL-23|zcyto18
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 16kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: APISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI
Uniprot:: Q9GZX6
Synonyme:: cytokine Zcyto18;IL-10-related T-cell-derived inducible factor;IL-10-related T-cell-derived-inducible factor;IL-21;IL-22;IL-D110;IL-TIF;ILTIF;interleukin-22;TIFa;TIFIL-23;zcyto18
Weitere Details:: This gene is a member of the IL10 family of cytokines that mediate cellular inflammatory responses. The encoded protein functions in antimicrobial defense at mucosal surfaces and in tissue repair. This protein also has pro-inflammatory properties and plays a role in in the pathogenesis of several intestinal diseases. The encoded protein is a crucial cytokine that regulates host immunity in infectious diseases, including COVID-19 (disease caused by SARS-CoV-2).