G Gamma-Tubulin Rabbit polyclonal antibody

Größe

£152.00

SKU:: A6215
Zusätzliche Namen:: CDCBM4|GCP-1|TUBG|TUBGCP1|G Gamma-Tubulin
Anwendung:: ELISA, WB
Molekulargewicht:: 50kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: TSISSLFERTCRQYDKLRKREAFLEQFRKEDMFKDNFDEMDTSREIVQQLIDEYHAATRPDYISWGTQEQ
Uniprot:: P23258
Synonyme:: CDCBM4;Gamma-1-tubulin;gamma-tubulin complex component 1;GCP-1;TUBG;TUBGCP1;tubulin gamma-1 chain;tubulin, gamma polypeptide
Weitere Details:: This gene encodes a member of the tubulin superfamily. The encoded protein localizes to the centrosome where it binds to microtubules as part of a complex referred to as the gamma-tubulin ring complex. The protein mediates microtubule nucleation and is required for microtubule formation and progression of the cell cycle. A pseudogene of this gene is found on chromosome 7.