A6207
IL2RB Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A6207
- Zusätzliche Namen:
- CD122|IL15RB|IL2RB|IMD63|P70-75
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 75kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- GGLAPEISPLEVLERDKVTQLLLQQDKVPEPASLSSNHSLTSCFTNQGYFFFHLPDALEIEACQVYFTYDPYSEEDPDEGVAGAPTGSSPQPLQPLSGEDDAYCTFPSRDDLLLFS
- Uniprot:
- P14784
- Synonyme:
- CD122;CD122 antigen;high affinity IL-2 receptor beta subunit;high affinity IL-2 receptor subunit beta;IL-2 receptor subunit beta;IL-2R subunit beta;IL-2RB;IL15RB;IMD63;interleukin 15 receptor, beta;interleukin 2 receptor, beta;interleukin-15 receptor subunit beta;interleukin-2 receptor subunit beta;P70-75;p75
- Weitere Details:
- The interleukin 2 receptor, which is involved in T cell-mediated immune responses, is present in 3 forms with respect to ability to bind interleukin 2. The low affinity form is a monomer of the alpha subunit and is not involved in signal transduction. The intermediate affinity form consists of an alpha/beta subunit heterodimer, while the high affinity form consists of an alpha/beta/gamma subunit heterotrimer. Both the intermediate and high affinity forms of the receptor are involved in receptor-mediated endocytosis and transduction of mitogenic signals from interleukin 2. The protein encoded by this gene represents the beta subunit and is a type I membrane protein. The use of alternative promoters results in multiple transcript variants encoding the same protein. The protein is primarily expressed in the hematopoietic system. The use by some variants of an alternate promoter in an upstream long terminal repeat (LTR) results in placenta-specific expression.
- Versandbedingungen:
- Blue Ice



