A6192
ANKRD1 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A6192
- Zusätzliche Namen:
- ALRP|ANKRD1|bA320F15.2|C-193|CARP|CVARP|MCARP
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 36 kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MMVLKVEELVTGKKNGNGEAGEFLPEDFRDGEYEAAVTLEKQEDLKTLLAHPVTLGEQQWKSEKQREAELKKKKLEQRSKLENLEDLEIIIQLKKRKKYRKTKVPVVKEPEPEIITEPVDVPTFLKAALE
- Uniprot:
- Q15327
- Synonyme:
- ALRP;ankyrin repeat domain 1 (cardiac muscle);ankyrin repeat domain-containing protein 1;bA320F15.2;C-193;cardiac ankyrin repeat protein;CARP;CVARP;cytokine-inducible gene C-193 protein;cytokine-inducible nuclear protein;epididymis secretory sperm binding protein;liver ankyrin repeat domain 1;MCARP
- Weitere Details:
- The protein encoded by this gene is localized to the nucleus of endothelial cells and is induced by IL-1 and TNF-alpha stimulation. Studies in rat cardiomyocytes suggest that this gene functions as a transcription factor. Interactions between this protein and the sarcomeric proteins myopalladin and titin suggest that it may also be involved in the myofibrillar stretch-sensor system.
- Versandbedingungen:
- Blue Ice