TNFRSF10D Rabbit polyclonal antibody

Größe

£152.00

SKU:: A6136
Zusätzliche Namen:: CD264|DCR2|TNFRSF10D|TRAIL-R4|TRAILR4|TRUNDD
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 47kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: VLFRRRSCPSRVPGAEDNARNETLSNRYLQPTQVSEQEIQGQELAELTGVTVELPEEPQRLLEQAEAEGCQRRRLLVPVNDADSADISTLLDASATLEEGHAKETIQDQLVGSEKLFYEEDEAGSATSCL
Uniprot:: Q9UBN6
Synonyme:: CD264;DCR2;decoy receptor 2;TNF receptor-related receptor for TRAIL;TNF-related apoptosis-inducing ligand receptor 4;TRAIL receptor 4;TRAIL receptor with a truncated death domain;TRAIL-R4;TRAILR4;TRUNDD;tumor necrosis factor receptor superfamily member 10D;tumor necrosis factor receptor superfamily, member 10d, decoy with truncated death domain
Weitere Details:: The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor contains an extracellular TRAIL-binding domain, a transmembrane domain, and a truncated cytoplamic death domain. This receptor does not induce apoptosis, and has been shown to play an inhibitory role in TRAIL-induced cell apoptosis.