A6135
ST14 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A6135
- Zusätzliche Namen:
- ARCI11|CAP3|HAI|MT-SP1|MTSP1|PRSS14|SNC19|ST14|TADG15|TMPRSS14
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 95kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- TCTKHTYRCLNGLCLSKGNPECDGKEDCSDGSDEKDCDCGLRSFTRQARVVGGTDADEGEWPWQVSLHALGQGHICGASLISPNWLVSAAHCYIDDRGFRYSDPTQWTAFLGLHDQSQRSAPGVQERRLKRIISHPFFNDFTFDYDIALLELEKPAEYSSMVRPICLPDASHVFPAGKAIWVTGWGHTQYGGTGALILQKGEIRVINQTTCENLLPQQITPRMMCVGFLSGGVDSCQGDSGGPLSSVEADGRIFQAGVVSWGDGCAQRNKPGVYTRLPLFRDWIKENTGV
- Uniprot:
- Q9Y5Y6
- Synonyme:
- ARCI11;CAP3;channel-activating protein 3;HAI;Matriptase;membrane-type serine protease 1;MT-SP1;MTSP1;prostamin;PRSS14;serine protease 14;serine protease TADG-15;SNC19;suppression of tumorigenicity 14 (colon carcinoma, matriptase, epithin);suppression of tumorigenicity 14 (colon carcinoma);suppressor of tumorigenicity 14 protein;TADG15;TMPRSS14;tumor associated differentially expressed gene 15 protein;Tumor-associated differentially-expressed gene 15 protein
- Weitere Details:
- The protein encoded by this gene is an epithelial-derived, integral membrane serine protease. This protease forms a complex with the Kunitz-type serine protease inhibitor, HAI-1, and is found to be activated by sphingosine 1-phosphate. This protease has been shown to cleave and activate hepatocyte growth factor/scattering factor, and urokinase plasminogen activator, which suggest the function of this protease as an epithelial membrane activator for other proteases and latent growth factors. The expression of this protease has been associated with breast, colon, prostate, and ovarian tumors, which implicates its role in cancer invasion, and metastasis.
- Versandbedingungen:
- Blue Ice

