A6129
GSTZ1 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A6129
- Zusätzliche Namen:
- GSTZ1|GSTZ1-1|MAAI|MAAID|MAI
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 24kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MQAGKPILYSYFRSSCSWRVRIALALKGIDYETVPINLIKDGGQQFSKDFQALNPMKQVPTLKIDGITIHQSLAIIEYLEEMRPTPRLLPQDPKKRASVRMISDLIAGGIQPLQNLSVLKQVGEEMQLTWAQNAITCGFNALEQILQSTAGIYCVGDEVTMADLCLVPQVANAERFKVDLTPYPTISSINKRLLVLEAFQVSHPCRQPDTPTELRA
- Uniprot:
- O43708
- Synonyme:
- glutathione S-alkyltransferase;glutathione S-aralkyltransferase;glutathione S-aryltransferase;Glutathione S-transferase zeta 1;glutathione transferase zeta 1;GSTZ1-1;MAAI;MAAID;MAI;maleylacetoacetate isomerase;maleylacetone isomerase;S-(hydroxyalkyl)glutathione lyase
- Weitere Details:
- This gene is a member of the glutathione S-transferase (GSTs) super-family which encodes multifunctional enzymes important in the detoxification of electrophilic molecules, including carcinogens, mutagens, and several therapeutic drugs, by conjugation with glutathione. This enzyme catalyzes the conversion of maleylacetoacetate to fumarylacetoacatate, which is one of the steps in the phenylalanine/tyrosine degradation pathway. Deficiency of a similar gene in mouse causes oxidative stress. Several transcript variants of this gene encode multiple protein isoforms.
- Versandbedingungen:
- Blue Ice