A6127
CSF2 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A6127
- Zusätzliche Namen:
- CSF|CSF2|GMCSF
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 16kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASH
- Uniprot:
- P04141
- Synonyme:
- colony stimulating factor 2 (granulocyte-macrophage);Colony-stimulating factor;CSF;GMCSF;granulocyte macrophage-colony stimulating factor;granulocyte-macrophage colony-stimulating factor;molgramostim;molgramostin;sargramostim
- Weitere Details:
- The protein encoded by this gene is a cytokine that controls the production, differentiation, and function of granulocytes and macrophages. The active form of the protein is found extracellularly as a homodimer. This gene has been localized to a cluster of related genes at chromosome region 5q31, which is known to be associated with interstitial deletions in the 5q- syndrome and acute myelogenous leukemia. Other genes in the cluster include those encoding interleukins 4, 5, and 13. This gene plays a role in promoting tissue inflammation. Elevated levels of cytokines, including the one produced by this gene, have been detected in SARS-CoV-2 infected patients that develop acute respiratory distress syndrome. Mice deficient in this gene or its receptor develop pulmonary alveolar proteinosis.
- Versandbedingungen:
- Blue Ice