TNRC6A Rabbit polyclonal antibody

Größe

£152.00

SKU:: A6115
Zusätzliche Namen:: CAGH26|FAME6|GW1|GW182|TNRC6|TNRC6A
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 180kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: QDIVGSWGIPPATGKPPGTGWLGGPIPAPAKEEEPTGWEEPSPESIRRKMEIDDGTSAWGDPSKYNYKNVNMWNKNVPNGNSRSDQQAQVHQLLTPASAIS
Uniprot:: Q8NDV7
Synonyme:: CAG repeat protein 26;CAGH26;CTD-2540M10.1;EDIE;EMSY interactor protein;FAME6;glycine-tryptophan protein of 182 kDa;GW1;GW182;GW182 autoantigen;TNRC6;trinucleotide repeat containing 6A;trinucleotide repeat-containing gene 6A protein
Weitere Details:: This gene encodes a member of the trinucleotide repeat containing 6 protein family. The protein functions in post-transcriptional gene silencing through the RNA interference (RNAi) and microRNA pathways. The protein associates with messenger RNAs and Argonaute proteins in cytoplasmic bodies known as GW-bodies or P-bodies. Inhibiting expression of this gene delocalizes other GW-body proteins and impairs RNAi and microRNA-induced gene silencing.