SRSF10 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A6024
Zusätzliche Namen:: FUSIP1|FUSIP2|NSSR|PPP1R149|SFRS13|SFRS13A|SRp38|SRrp40|SRSF10|TASR|TASR1|TASR2
Anwendung:: ELISA, WB
Molekulargewicht:: 40kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: DRFKHRNRSFSRSKSNSRSRSKSQPKKEMKAKSRSRSASHTKTRGTSKTDSKTHYKSGSRYEKESRKKEPPRSKSQSRSQSRSRSKSRSRSWTSPKSSGH
Uniprot:: O75494
Synonyme:: 40 kDa SR-repressor protein;FUS interacting protein (serine-arginine rich) 1;FUS-interacting protein (serine-arginine rich) 2;FUS-interacting serine-arginine-rich protein 1;FUSIP1;FUSIP2;neural-salient SR protein;NSSR;PPP1R149;protein phosphatase 1, regulatory subunit 149;serine-arginine repressor protein (40 kDa);serine/arginine-rich splicing factor 10;SFRS13;SFRS13A;splicing factor SRp38;splicing factor, arginine/serine-rich 13;splicing factor, arginine/serine-rich 13A;SR splicing factor 10;SRp38;SRrp40;TASR;TASR1;TASR2;TLS-associated protein TASR;TLS-associated protein with Ser-Arg repeats;TLS-associated protein with SR repeats;TLS-associated serine-arginine protein;TLS-associated serine-arginine protein 1;TLS-associated serine-arginine protein 2;TLS-associated SR protein
Weitere Details:: This gene product is a member of the serine-arginine (SR) family of proteins, which are involved in constitutive and regulated RNA splicing. Members of this family are characterized by N-terminal RNP1 and RNP2 motifs, which are required for binding to RNA, and multiple C-terminal SR/RS repeats, which are important in mediating association with other cellular proteins. This protein interacts with the oncoprotein TLS, and abrogates the influence of TLS on adenovirus E1A pre-mRNA splicing. This gene has pseudogenes on chromosomes 4, 9, 14, 18, and 20. Alternative splicing results in multiple transcript variants.

Versandbedingungen:: Blue Ice