A6022
AGO1 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A6022
- Zusätzliche Namen:
- AGO1|EIF2C|EIF2C1|GERP95|hAgo1|NEDLBAS|Q99
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 100kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MEAGPSGAAAGAYLPPLQQVFQAPRRPGIGTVGKPIKLLANYFEVDIPKIDVYHYEVDIKPDKCPRRVNREVVEYMVQHFKPQIFGDRKPVYDGKKNIYTVTALPIGNERVDFEVTIPGEGKDRIFKVSIKWLAIVSWRMLHEALVSGQIPVPLESVQALDVAMRHLASM
- Uniprot:
- Q9UL18
- Synonyme:
- argonaute 1, RISC catalytic component;argonaute RISC catalytic component 1;argonaute1;eIF-2C 1;EIF2C;eIF2C 1;EIF2C1;Eukaryotic translation initiation factor 2C 1;eukaryotic translation initiation factor 2C, 1;GERP95;Golgi Endoplasmic Reticulum protein 95 kDa;hAgo1;protein argonaute-1;putative RNA-binding protein Q99;Q99
- Weitere Details:
- This gene encodes a member of the argonaute family of proteins, which associate with small RNAs and have important roles in RNA interference (RNAi) and RNA silencing. This protein binds to microRNAs (miRNAs) or small interfering RNAs (siRNAs) and represses translation of mRNAs that are complementary to them. It is also involved in transcriptional gene silencing (TGS) of promoter regions that are complementary to bound short antigene RNAs (agRNAs), as well as in the degradation of miRNA-bound mRNA targets. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. A recent study showed this gene to be an authentic stop codon readthrough target, and that its mRNA could give rise to an additional C-terminally extended isoform by use of an alternative in-frame translation termination codon.
- Versandbedingungen:
- Blue Ice



